Free shipping & free returns
31-day return policy
Since 1921: Your expert for hand-knotted oriental rugs
About us
Contact us
FAQ
Rugeast Logo
Home
Traditional and Persian Rugs
Nomadic- Village Carpets
Modern Rugs
Machine made carpets
Antique Rugs
All Carpets
Rugeast – Tradition Since 1921
For over three generations, our family has been devoted to the art of handcrafted carpets. From the historic bazaars of Tehran to Hamburg’s Speicherstadt, Rugeast blends tradition with modern innovation, bringing unique carpets from around the world directly to you.
Showroom
Brook 9
20457 Hamburg
Germany
Contact
+49(0) 40 37 50 27 66
info[@]rugeast.com
Opening hours
Monday to Friday - 08:00 to 18:00
Saturday - 09:00 to 15:00
Sunday - Closed
Services
Terms of useImprintReturn PolicyPrivacy Policy
Useful Links
About usFAQBlogContact
© 2005 - 2025 Rugeast. All rights reserved.
paypalmastercardvisasepa-lastschriftupsdpddhlssltrustedshop

KidsCarpets

Discover our beautiful collection of carpets

teppich
Home/carpet/modern-carpets/kids-carpets
Showing 1-24 of 24 Results
kidsrug Alphabet Carpet 242x169kidsrug Alphabet Carpet 242x169 - alternate view

kidsrug Alphabet Carpet 242x169

249.00 €
Kidsrugcarpetunicornandstar  Carpet 244x168Kidsrugcarpetunicornandstar  Carpet 244x168 - alternate view

Kidsrugcarpetunicornandstar Carpet 244x168

199.00 €
kidsrugAlphabet Carpet 243x168kidsrugAlphabet Carpet 243x168 - alternate view

kidsrugAlphabet Carpet 243x168

279.00 €
childr Carpet 243x170childr Carpet 243x170 - alternate view

childr Carpet 243x170

290.00 €
childr Carpet 243x170childr Carpet 243x170 - alternate view

childr Carpet 243x170

340.00 €
childr Carpet 243x169childr Carpet 243x169 - alternate view

childr Carpet 243x169

330.00 €
-20%
childr Carpet 244x169childr Carpet 244x169 - alternate view

childr Carpet 244x169

350.00 €280.00 €
childr Carpet 243x169childr Carpet 243x169 - alternate view

childr Carpet 243x169

270.00 €
childr Carpet 243x170childr Carpet 243x170 - alternate view

childr Carpet 243x170

285.00 €
childr Carpet 244x169childr Carpet 244x169 - alternate view

childr Carpet 244x169

370.00 €
childr Carpet 243x170childr Carpet 243x170 - alternate view

childr Carpet 243x170

360.00 €
childr Carpet 244x170childr Carpet 244x170 - alternate view

childr Carpet 244x170

199.00 €
childr carpet 246x169childr carpet 246x169 - alternate view

childr carpet 246x169

299.00 €
-10%
childr Carpet 243x169childr Carpet 243x169 - alternate view

childr Carpet 243x169

350.00 €315.00 €
children's rug 246x171children's rug 246x171 - alternate view

children's rug 246x171

299.00 €
-20%
Childre carpet 245x170Childre carpet 245x170 - alternate view

Childre carpet 245x170

449.00 €359.20 €
-20%
Childer carpet  243x170Childer carpet  243x170 - alternate view

Childer carpet 243x170

399.00 €319.20 €
-10%
Childre carpet 243x169Childre carpet 243x169 - alternate view

Childre carpet 243x169

399.00 €359.10 €
chilre Carpet 242x170chilre Carpet 242x170 - alternate view

chilre Carpet 242x170

299.00 €
-10%
childre Carpet 243x169childre Carpet 243x169 - alternate view

childre Carpet 243x169

299.00 €269.10 €
childre Carpet  242x170childre Carpet  242x170 - alternate view

childre Carpet 242x170

239.00 €
children's Carpet  243x170children's Carpet  243x170 - alternate view

children's Carpet 243x170

299.00 €
-20%
childre carpet 243x170childre carpet 243x170 - alternate view

childre carpet 243x170

399.00 €319.20 €
Childre carpet 243x169Childre carpet 243x169 - alternate view

Childre carpet 243x169

299.00 €
  • 1

What features should a child's room carpet have?

In a family with children, perhaps the most important part of their home is the children's room. More important than the decoration of the children's room is creating a comfortable and safe space for the child, and carpets play a fundamental role in achieving such an environment.
Children's room carpets should be completely soft and washable. Carpets with very bright colors are not recommended for children's rooms. Carpets with cheerful, warm, and vibrant colors are highly suitable.
Anything designed for the flooring of a child's room has its own do's and don'ts. It's not about being overly sensitive to anything related to children, but let's not forget that the floor of a child's room is one of the most crucial aspects in decoration and even in maintaining the mental and physical health of children.
When choosing a carpet for a child's room, it's important to consider using one made from natural materials that are environmentally friendly and compatible with human health. The use of naturally dyed wool is also a requirement for these types of carpets.

Children's Room Carpet Color

Considering the space of a child's room and taking a look at the psychology of colors, it is possible to use colors such as lemon yellow, which stimulates the child's thinking abilities, and green, which promotes mental tranquility. Additionally, warm colors that create movement and excitement in children can also be considered for this type of carpet.

Children's Room Carpet Design

The use of childlike designs, such as the innocent drawings created by children themselves, to foster a child's interest in Iranian culture and traditions, and encourage them to buy Iranian products, is not without merit.
For designing carpets in a child's room, it seems better to use patterns with less complexity, incorporating fewer and simpler motifs. Additionally, epic designs such as some stories from Shahnameh or One Thousand and One Nights can be simplified and made understandable for children. Besides the storytelling aspect, the carpet can showcase a distinctly Iranian aesthetic, encouraging the child to pay attention to their identity and heritage.

Children's Room Carpet Dimensions

If the child's bed is positioned in a corner against the wall, it's possible to use traditional designs with moderate dimensions (medium-sized carpets) that closely align with the sides. This carpet piece can be placed parallel to the child's bed. Otherwise, depending on the room's size, using rug dimensions of four to six meters can also be a suitable option. It is preferable to have a smaller portion of the floor without a carpet, and the carpet in the child's room should preferably have longer piles. This way, there will be less chance of the child getting injured during play and childish mischief.
If we desire a soft and warm texture, vibrant yet stain-resistant color, if we can't replace it every two years, and if we want our growing child to establish a connection with the patterns in their room, we might find that a good solution is "handwoven carpets," especially "Gabbeh" carpets. They are considered one of the best choices for children's room flooring in all countries.
The most common entry point for foreign particles into a child's respiratory system is carpet fibers. Machine-made carpets, due to the use of petroleum-based and synthetic materials in their construction, cannot be easily broken down if they enter the respiratory system. This poses a risk of various allergies and respiratory diseases, especially for children and vulnerable elderly individuals. On the contrary, handwoven carpets, using natural sheep wool fibers that are protein-based and amino acid-rich, can be easily broken down by the human respiratory system. They pose minimal harm to the body when entering the respiratory system. Therefore, many health experts recommend using handwoven carpets, woven with natural fibers and plant-based (non-chemical) dyes, for children's rooms and for those susceptible to diseases, especially respiratory issues.
Another distinctive feature of handwoven carpets is their thermal adaptability in the home environment. Handwoven carpets tend to be cool in warm environments during summers and warm in cold environments during winters. In contrast, machine-made carpets woven with synthetic fibers tend to be cold in winter and warm in summer. The elastic and impact-absorbing properties of handwoven carpets are notable characteristics that set them apart.

View All
Single Color Carpets
Single Color Carpets
Bedroom Carpets
Bedroom Carpets
Berber/Shaggy
Berber/Shaggy
Designer Carpets
Designer Carpets
Kilim
Kilim
Gabbeh
Gabbeh
Loribaft
Loribaft
Vintage/Patchwork
Vintage/Patchwork
KidsCarpets
KidsCarpets
Handtufted Carpet
Handtufted Carpet