+49 (040) 37 50 27 66Monday to Saturday - 08:00 to 18:00Brook 9, 20457 Hamburg
About us
Contact us
FAQ
Home
Traditional and Persian Rugs
Nomadic- Village Carpets
Modern Rugs
Machine made carpets
Antique Rugs
Rugeast – Tradition Since 1921
Seit über drei Generationen widmet sich unsere Familie der Kunst handgefertigter Teppiche. Von den historischen Basaren Teherans bis zur Hamburger Speicherstadt verbindet Rugeast Tradition mit moderner Innovation und bringt einzigartige Teppiche aus aller Welt direkt zu Ihnen.
Showroom
Brook 9
20457 Hamburg
Germany
Contact
+49 (0) 40 37 50 27 66
info{@]rugeast.com
Opening hours
Monday to Friday - 08:00 to 18:00
Saturday - 09:00 to 15:00
Sunday - Closed
Bedingungen
Imprint
Terms of use
Privacy Policy
Return Policy
Useful Links
About us
FAQ
Blog
Contact
© 2005 - 2025 RugEast. All rights reserved.
paypalmastercardvisasepa-lastschriftupsdpddhlssltrustedshop

KidsCarpets

Discover our beautiful collection of carpets

teppich
///
Showing 1-24 of 40 Results
kidsrug Alphabet Carpet 242x169

kidsrug Alphabet Carpet 242x169

From249 €
Kidsrugcarpetunicornandstar  Carpet 244x168

Kidsrugcarpetunicornandstar Carpet 244x168

From199 €
kidsrugAlphabet Carpet 243x168

kidsrugAlphabet Carpet 243x168

From279 €
childr Carpet 243x170

childr Carpet 243x170

From290 €
childr Carpet 243x170

childr Carpet 243x170

From340 €
childr Carpet 243x169

childr Carpet 243x169

From330 €
childr Carpet 244x169

childr Carpet 244x169

From350 €
childr Carpet 243x169

childr Carpet 243x169

From270 €
childr Carpet 243x170

childr Carpet 243x170

From285 €
childr Carpet 244x169

childr Carpet 244x169

From370 €
childr Carpet 243x170

childr Carpet 243x170

From360 €
childr Carpet 244x170

childr Carpet 244x170

From199 €
childr carpet 246x169

childr carpet 246x169

From299 €
childr Carpet 243x169

childr Carpet 243x169

From350 €
children's rug 246x171

children's rug 246x171

From299 €
Childre carpet 245x170

Childre carpet 245x170

From449 €
Childer carpet  243x170

Childer carpet 243x170

From399 €
Childre carpet 243x169

Childre carpet 243x169

From399 €
chilre Carpet 242x170

chilre Carpet 242x170

From299 €
childre Carpet 243x169

childre Carpet 243x169

From299 €
childre Carpet  242x170

childre Carpet 242x170

From239 €
children's Carpet  243x170

children's Carpet 243x170

From299 €
childre carpet 243x170

childre carpet 243x170

From399 €
Childre carpet 243x169

Childre carpet 243x169

From299 €
  • 1
Load More

What features should a child's room carpet have?

In a family with children, perhaps the most important part of their home is the children's room. More important than the decoration of the children's room is creating a comfortable and safe space for the child, and carpets play a fundamental role in achieving such an environment.
Children's room carpets should be completely soft and washable. Carpets with very bright colors are not recommended for children's rooms. Carpets with cheerful, warm, and vibrant colors are highly suitable.
Anything designed for the flooring of a child's room has its own do's and don'ts. It's not about being overly sensitive to anything related to children, but let's not forget that the floor of a child's room is one of the most crucial aspects in decoration and even in maintaining the mental and physical health of children.
When choosing a carpet for a child's room, it's important to consider using one made from natural materials that are environmentally friendly and compatible with human health. The use of naturally dyed wool is also a requirement for these types of carpets.

Children's Room Carpet Color

Considering the space of a child's room and taking a look at the psychology of colors, it is possible to use colors such as lemon yellow, which stimulates the child's thinking abilities, and green, which promotes mental tranquility. Additionally, warm colors that create movement and excitement in children can also be considered for this type of carpet.

Children's Room Carpet Design

The use of childlike designs, such as the innocent drawings created by children themselves, to foster a child's interest in Iranian culture and traditions, and encourage them to buy Iranian products, is not without merit.
For designing carpets in a child's room, it seems better to use patterns with less complexity, incorporating fewer and simpler motifs. Additionally, epic designs such as some stories from Shahnameh or One Thousand and One Nights can be simplified and made understandable for children. Besides the storytelling aspect, the carpet can showcase a distinctly Iranian aesthetic, encouraging the child to pay attention to their identity and heritage.

Children's Room Carpet Dimensions

If the child's bed is positioned in a corner against the wall, it's possible to use traditional designs with moderate dimensions (medium-sized carpets) that closely align with the sides. This carpet piece can be placed parallel to the child's bed. Otherwise, depending on the room's size, using rug dimensions of four to six meters can also be a suitable option. It is preferable to have a smaller portion of the floor without a carpet, and the carpet in the child's room should preferably have longer piles. This way, there will be less chance of the child getting injured during play and childish mischief.
If we desire a soft and warm texture, vibrant yet stain-resistant color, if we can't replace it every two years, and if we want our growing child to establish a connection with the patterns in their room, we might find that a good solution is "handwoven carpets," especially "Gabbeh" carpets. They are considered one of the best choices for children's room flooring in all countries.
The most common entry point for foreign particles into a child's respiratory system is carpet fibers. Machine-made carpets, due to the use of petroleum-based and synthetic materials in their construction, cannot be easily broken down if they enter the respiratory system. This poses a risk of various allergies and respiratory diseases, especially for children and vulnerable elderly individuals. On the contrary, handwoven carpets, using natural sheep wool fibers that are protein-based and amino acid-rich, can be easily broken down by the human respiratory system. They pose minimal harm to the body when entering the respiratory system. Therefore, many health experts recommend using handwoven carpets, woven with natural fibers and plant-based (non-chemical) dyes, for children's rooms and for those susceptible to diseases, especially respiratory issues.
Another distinctive feature of handwoven carpets is their thermal adaptability in the home environment. Handwoven carpets tend to be cool in warm environments during summers and warm in cold environments during winters. In contrast, machine-made carpets woven with synthetic fibers tend to be cold in winter and warm in summer. The elastic and impact-absorbing properties of handwoven carpets are notable characteristics that set them apart.

Home
carpet
modern-carpets
kids-carpets
View All
Single Color Carpets
Single Color Carpets
Bedroom Carpets
Bedroom Carpets
Berber/Shaggy
Berber/Shaggy
Designer Carpets
Designer Carpets
Kilim
Kilim
Gabbeh
Gabbeh
loribaft
loribaft
Vintage/Patchwork
Vintage/Patchwork
KidsCarpets
KidsCarpets
Handtufted Carpet
Handtufted Carpet