+49(0) 40 37 50 27 66
Mon - Fri: 8am - 6pm
Brook 9, 20457 Hamburg
About us
Contact us
FAQ
Rugeast Logo
Home
Traditional and Persian Rugs
Nomadic- Village Carpets
Modern Rugs
Machine made carpets
Antique Rugs
Rugeast – Tradition Since 1921
For over three generations, our family has been devoted to the art of handcrafted carpets. From the historic bazaars of Tehran to Hamburg’s Speicherstadt, Rugeast blends tradition with modern innovation, bringing unique carpets from around the world directly to you.
Showroom
Brook 9
20457 Hamburg
Germany
Contact
+49(0) 40 37 50 27 66
info[@]rugeast.com
Opening hours
Monday to Friday - 08:00 to 18:00
Saturday - 09:00 to 15:00
Sunday - Closed
Services
Terms of useImprintReturn PolicyPrivacy Policy
Useful Links
About usFAQBlogContact
© 2005 - 2025 Rugeast. All rights reserved.
paypalmastercardvisasepa-lastschriftupsdpddhlssltrustedshop

Bidjar

Discover our beautiful collection of carpets

teppich
Home/carpet/orientalcarpets/bidjar
Showing 1-24 of 158 Results
Bidjar Carpet 78x54Bidjar Carpet 78x54 - alternate view

Bidjar Carpet 78x54

295.00 €
Zanjan Carpet  90x56Zanjan Carpet  90x56 - alternate view

Zanjan Carpet 90x56

295.00 €
Antique BIDJAR Carpet  218x140Antique BIDJAR Carpet  218x140 - alternate view

Antique BIDJAR Carpet 218x140

1450.00 €
BIDJAR Carpet  185x109BIDJAR Carpet  185x109 - alternate view

BIDJAR Carpet 185x109

1400.00 €
BIDJAR Carpet 181x109BIDJAR Carpet 181x109 - alternate view

BIDJAR Carpet 181x109

1400.00 €
Bidjar  Carpet 255x57Bidjar  Carpet 255x57 - alternate view

Bidjar Carpet 255x57

650.00 €
Senneh Carpet 169x124Senneh Carpet 169x124 - alternate view

Senneh Carpet 169x124

399.00 €
Bidjar Carpet 112x77Bidjar Carpet 112x77 - alternate view

Bidjar Carpet 112x77

200.00 €
Bidjar Carpet  50x57Bidjar Carpet  50x57 - alternate view

Bidjar Carpet 50x57

195.00 €
Bidjar Carpet  291x119Bidjar Carpet  291x119 - alternate view

Bidjar Carpet 291x119

1399.00 €
Bidjar Carpet 90x60Bidjar Carpet 90x60 - alternate view

Bidjar Carpet 90x60

295.00 €
Antique Senneh Carpet 190x131Antique Senneh Carpet 190x131 - alternate view

Antique Senneh Carpet 190x131

4700.00 €
Seeneh Antique Carpet 98x50Seeneh Antique Carpet 98x50 - alternate view

Seeneh Antique Carpet 98x50

450.00 €
Sarab Antiqu  Carpet 313x234Sarab Antiqu  Carpet 313x234 - alternate view

Sarab Antiqu Carpet 313x234

1800.00 €
Bidjar Antique Carpet 200x133Bidjar Antique Carpet 200x133 - alternate view

Bidjar Antique Carpet 200x133

1500.00 €
Bidjar Antique Carpet 550x115Bidjar Antique Carpet 550x115 - alternate view

Bidjar Antique Carpet 550x115

3900.00 €
Senneh Carpet 298x196Senneh Carpet 298x196 - alternate view

Senneh Carpet 298x196

1400.00 €
Bidjar Carpet 315x212Bidjar Carpet 315x212 - alternate view

Bidjar Carpet 315x212

2600.00 €
Bidjar carpet 292x256Bidjar carpet 292x256 - alternate view

Bidjar carpet 292x256

3950.00 €
Bidjar Carpet 235x195Bidjar Carpet 235x195 - alternate view

Bidjar Carpet 235x195

2200.00 €
Bidjar Carpet 290x208Bidjar Carpet 290x208 - alternate view

Bidjar Carpet 290x208

2950.00 €
Sarough Carpet 305x240Sarough Carpet 305x240 - alternate view

Sarough Carpet 305x240

1100.00 €
Bidjar Carpet 342x247Bidjar Carpet 342x247 - alternate view

Bidjar Carpet 342x247

3500.00 €
Bidjar Carpet 146x95Bidjar Carpet 146x95 - alternate view

Bidjar Carpet 146x95

350.00 €

    Bidjar carpet is one of the most durable and tightly-woven Persian rugs available today. Known as the “Iron Rug of Persia,” it’s built to last. Kurdish artisans in the town of Bijar weave these masterpieces using ancient techniques. Each rug combines art, tradition, and exceptional durability. The dense wool pile and firm knotting structure resist wear and pressure over time. These carpets are ideal for high-traffic spaces in elegant interiors.

    Bidjar carpets are famous for their heavy structure and flat surface. They rarely wrinkle or fold, keeping their form for decades. At Rugeast, we offer only authentic handmade versions. Each rug is carefully selected, ensuring top quality and origin authenticity. With deep reds, rich blues, and ivory tones, a Bidjar carpet adds warmth and character to any room.

    Persian Bidjar Carpet Rug

    What Makes Bidjar Rugs Unique?

    Bijar rugs are woven in northwestern Iran, mainly by Kurdish tribes. Each knot is compressed using a wet-packing method that creates an unusually tight structure. The wool is thick, naturally dyed, and extremely resilient. Many call it the most “practical” Persian rug ever made. Bidjar carpets often feature medallion designs or all-over patterns like the Herati motif. The borders are strong and geometrically aligned. A typical Bidjar can weigh much more than other rugs of the same size. This makes it lay flat and remain stable under furniture.

    Synonyms such as “Bijar rug” and “Kurdish carpet” are often used when referring to these rugs. The value comes from the combination of strong craftsmanship and classical beauty. Designs vary between tribal elements and more urban floral patterns. Some Bidjar pieces also carry tribal symbolism rooted in Kurdish heritage.

    Key Characteristics of a Bidjar Carpet

    • Origin: Bijar, Kurdistan Province, Iran
    • Material: Hand-spun wool on cotton or wool foundation
    • Knotting: High-density Persian knots (up to 500,000 knots/m²)
    • Color palette: Deep red, navy blue, ivory, and green
    • Designs: Herati, medallions, floral motifs
    • Durability: Among the strongest of all Persian rugs
    Bidjar Carpet in Interior Design

    Where to Place a Bidjar Rug

    The Bidjar carpet is ideal for rooms where both beauty and strength are required. It performs well in high-use areas such as dining rooms and hallways. A large Bijar rug anchors living room furniture, while a smaller one fits well in bedrooms or offices. The thick structure resists indentations from chairs and tables. In modern interiors, a Bidjar rug balances minimalism with historic charm. In traditional homes, it enhances the classic Persian decor. Whether you have a bohemian, rustic, or luxury style, there’s a Bidjar rug to match it.

    How to Care for Your Bidjar Carpet

    Due to its density, a Bidjar carpet requires only simple care. Vacuum it regularly using suction without rotating brushes. Avoid moisture exposure. Rotate it every few months for even wear. For stains, blot the area with dry cloth, avoiding aggressive rubbing. Professional cleaning is recommended every few years to maintain color and fiber quality. With proper care, these carpets last for generations and often increase in value over time.

    Why Choose a Bidjar Carpet from Rugeast?

    At Rugeast, we specialize in authentic handmade rugs. Our Bidjar carpets are sourced from trusted Iranian producers. We guarantee original materials, ethical production, and expert craftsmanship. Every rug is inspected and stored in our Hamburg warehouse. Shipping is fast and secure across Germany and Europe. All carpets come with a return guarantee and optional certificate of authenticity. We help you choose the right size, design, and weave for your space.

    Available Sizes

    • 200 x 140 cm – Ideal for bedrooms or small dining areas
    • 250 x 170 cm – Versatile for living rooms or offices
    • 300 x 200 cm – Great for large spaces and lounges
    • Runner sizes – Perfect for hallways or long entrances

    Order Your Bidjar Carpet Online

    Whether you seek a dense Persian rug for daily use or a collector’s piece, our Bijar collection is unmatched in quality. Shop safely with us at Rugeast and get access to real handmade Kurdish carpets. Our catalog includes antique Bidjar rugs, tribal patterns, and contemporary interpretations. Each carpet is unique, rich in history, and built to endure for years.

    Conclusion

    Choosing a Bidjar carpet means choosing a legacy of strength, beauty, and timeless Persian tradition. Browse our collection today and transform your space. Visit www.rugeast.com to explore the full range. Rugeast – Handmade carpets, delivered with care.

    View All
    Abadeh
    Abadeh
    Afghan & Pakistan Rugs
    Afghan & Pakistan Rugs
    Ardebil
    Ardebil
    Bidjar
    Bidjar
    Chinese Rugs
    Chinese Rugs
    Exclusive Carpets
    Exclusive Carpets
    Ghom
    Ghom
    Indian Carpets
    Indian Carpets
    Isfahan
    Isfahan
    Kashan
    Kashan
    Mashhad
    Mashhad
    Kerman
    Kerman
    Kashmar
    Kashmar
    Moud
    Moud
    Nain
    Nain
    Sarough
    Sarough
    Silk rugs
    Silk rugs
    Tabriz
    Tabriz
    Zanjan
    Zanjan
    Ziegler/Kazak
    Ziegler/Kazak