+49 (040) 37 50 27 66Monday to Saturday - 08:00 to 18:00Brook 9, 20457 Hamburg
About us
Contact us
FAQ
Home
Traditional and Persian Rugs
Nomadic- Village Carpets
Modern Rugs
Machine made carpets
Antique Rugs
Rugeast – Tradition Since 1921
Seit über drei Generationen widmet sich unsere Familie der Kunst handgefertigter Teppiche. Von den historischen Basaren Teherans bis zur Hamburger Speicherstadt verbindet Rugeast Tradition mit moderner Innovation und bringt einzigartige Teppiche aus aller Welt direkt zu Ihnen.
Showroom
Brook 9
20457 Hamburg
Germany
Contact
+49 (0) 40 37 50 27 66
info{@]rugeast.com
Opening hours
Monday to Friday - 08:00 to 18:00
Saturday - 09:00 to 15:00
Sunday - Closed
Bedingungen
Imprint
Terms of use
Privacy Policy
Return Policy
Useful Links
About us
FAQ
Blog
Contact
© 2005 - 2025 RugEast. All rights reserved.
paypalmastercardvisasepa-lastschriftupsdpddhlssltrustedshop

Bidjar

Discover our beautiful collection of carpets

teppich
Home/carpet/orientalcarpets/bidjar
Showing 1-24 of 156 Results
Bidjar Carpet 78x54

Bidjar Carpet 78x54

From295 €
Zanjan Carpet  90x56

Zanjan Carpet 90x56

From295 €
Antique BIDJAR Carpet  218x140

Antique BIDJAR Carpet 218x140

From1450 €
BIDJAR Carpet  185x109

BIDJAR Carpet 185x109

From1400 €
BIDJAR Carpet 181x109

BIDJAR Carpet 181x109

From1400 €
Bidjar  Carpet 255x57

Bidjar Carpet 255x57

From650 €
Bidjar Carpet  50x57

Bidjar Carpet 50x57

From195 €
Bidjar Carpet  291x119

Bidjar Carpet 291x119

From1399 €
Bidjar Carpet 90x60

Bidjar Carpet 90x60

From295 €
Antique Senneh Carpet 190x131

Antique Senneh Carpet 190x131

From4700 €
Seeneh Antique Carpet 98x50

Seeneh Antique Carpet 98x50

From450 €
Sarab Antiqu  Carpet 313x234

Sarab Antiqu Carpet 313x234

From1800 €
Bidjar Antique Carpet 200x133

Bidjar Antique Carpet 200x133

From1500 €
Bidjar Antique Carpet 550x115

Bidjar Antique Carpet 550x115

From3900 €
Senneh Carpet 298x196

Senneh Carpet 298x196

From1400 €
Bidjar Carpet 315x212

Bidjar Carpet 315x212

From2600 €
Bidjar carpet 292x256

Bidjar carpet 292x256

From3950 €
Bidjar Carpet 235x195

Bidjar Carpet 235x195

From2200 €
Bidjar Carpet 290x208

Bidjar Carpet 290x208

From2950 €
Sarough Carpet 305x240

Sarough Carpet 305x240

From1100 €
Bidjar Carpet 342x247

Bidjar Carpet 342x247

From3500 €
Bidjar Carpet 146x95

Bidjar Carpet 146x95

From350 €
Senneh carpet 162x114

Senneh carpet 162x114

From550 €
Bidjar carpet 142x77

Bidjar carpet 142x77

From250 €
  • 1
Load More

Bidjar carpet is one of the most durable and tightly-woven Persian rugs available today. Known as the “Iron Rug of Persia,” it’s built to last. Kurdish artisans in the town of Bijar weave these masterpieces using ancient techniques. Each rug combines art, tradition, and exceptional durability. The dense wool pile and firm knotting structure resist wear and pressure over time. These carpets are ideal for high-traffic spaces in elegant interiors.

Bidjar carpets are famous for their heavy structure and flat surface. They rarely wrinkle or fold, keeping their form for decades. At Rugeast, we offer only authentic handmade versions. Each rug is carefully selected, ensuring top quality and origin authenticity. With deep reds, rich blues, and ivory tones, a Bidjar carpet adds warmth and character to any room.

Persian Bidjar Carpet Rug

What Makes Bidjar Rugs Unique?

Bijar rugs are woven in northwestern Iran, mainly by Kurdish tribes. Each knot is compressed using a wet-packing method that creates an unusually tight structure. The wool is thick, naturally dyed, and extremely resilient. Many call it the most “practical” Persian rug ever made. Bidjar carpets often feature medallion designs or all-over patterns like the Herati motif. The borders are strong and geometrically aligned. A typical Bidjar can weigh much more than other rugs of the same size. This makes it lay flat and remain stable under furniture.

Synonyms such as “Bijar rug” and “Kurdish carpet” are often used when referring to these rugs. The value comes from the combination of strong craftsmanship and classical beauty. Designs vary between tribal elements and more urban floral patterns. Some Bidjar pieces also carry tribal symbolism rooted in Kurdish heritage.

Key Characteristics of a Bidjar Carpet

  • Origin: Bijar, Kurdistan Province, Iran
  • Material: Hand-spun wool on cotton or wool foundation
  • Knotting: High-density Persian knots (up to 500,000 knots/m²)
  • Color palette: Deep red, navy blue, ivory, and green
  • Designs: Herati, medallions, floral motifs
  • Durability: Among the strongest of all Persian rugs
Bidjar Carpet in Interior Design

Where to Place a Bidjar Rug

The Bidjar carpet is ideal for rooms where both beauty and strength are required. It performs well in high-use areas such as dining rooms and hallways. A large Bijar rug anchors living room furniture, while a smaller one fits well in bedrooms or offices. The thick structure resists indentations from chairs and tables. In modern interiors, a Bidjar rug balances minimalism with historic charm. In traditional homes, it enhances the classic Persian decor. Whether you have a bohemian, rustic, or luxury style, there’s a Bidjar rug to match it.

How to Care for Your Bidjar Carpet

Due to its density, a Bidjar carpet requires only simple care. Vacuum it regularly using suction without rotating brushes. Avoid moisture exposure. Rotate it every few months for even wear. For stains, blot the area with dry cloth, avoiding aggressive rubbing. Professional cleaning is recommended every few years to maintain color and fiber quality. With proper care, these carpets last for generations and often increase in value over time.

Why Choose a Bidjar Carpet from Rugeast?

At Rugeast, we specialize in authentic handmade rugs. Our Bidjar carpets are sourced from trusted Iranian producers. We guarantee original materials, ethical production, and expert craftsmanship. Every rug is inspected and stored in our Hamburg warehouse. Shipping is fast and secure across Germany and Europe. All carpets come with a return guarantee and optional certificate of authenticity. We help you choose the right size, design, and weave for your space.

Available Sizes

  • 200 x 140 cm – Ideal for bedrooms or small dining areas
  • 250 x 170 cm – Versatile for living rooms or offices
  • 300 x 200 cm – Great for large spaces and lounges
  • Runner sizes – Perfect for hallways or long entrances

Order Your Bidjar Carpet Online

Whether you seek a dense Persian rug for daily use or a collector’s piece, our Bijar collection is unmatched in quality. Shop safely with us at Rugeast and get access to real handmade Kurdish carpets. Our catalog includes antique Bidjar rugs, tribal patterns, and contemporary interpretations. Each carpet is unique, rich in history, and built to endure for years.

Conclusion

Choosing a Bidjar carpet means choosing a legacy of strength, beauty, and timeless Persian tradition. Browse our collection today and transform your space. Visit www.rugeast.com to explore the full range. Rugeast – Handmade carpets, delivered with care.

View All
Abadeh
Abadeh
Afghan & Pakistan Rugs
Afghan & Pakistan Rugs
Ardebil
Ardebil
Bidjar
Bidjar
Chinese Rugs
Chinese Rugs
Exclusive Carpets
Exclusive Carpets
Ghom
Ghom
Indian Carpets
Indian Carpets
Isfahan
Isfahan
Kashan
Kashan
Mashhad
Mashhad
Kerman
Kerman
Kashmar
Kashmar
Moud
Moud
Nain
Nain
Sarough
Sarough
Silk rugs
Silk rugs
Tabriz
Tabriz
Zanjan
Zanjan
Ziegler/Kazak
Ziegler/Kazak