+49(0) 40 37 50 27 66
Mon - Fri: 8am - 6pm
Brook 9, 20457 Hamburg
About us
Contact us
FAQ
Rugeast Logo
Home
Traditional and Persian Rugs
Nomadic- Village Carpets
Modern Rugs
Machine made carpets
Antique Rugs
Rugeast – Tradition Since 1921
For over three generations, our family has been devoted to the art of handcrafted carpets. From the historic bazaars of Tehran to Hamburg’s Speicherstadt, Rugeast blends tradition with modern innovation, bringing unique carpets from around the world directly to you.
Showroom
Brook 9
20457 Hamburg
Germany
Contact
+49(0) 40 37 50 27 66
info[@]rugeast.com
Opening hours
Monday to Friday - 08:00 to 18:00
Saturday - 09:00 to 15:00
Sunday - Closed
Services
Terms of useImprintReturn PolicyPrivacy Policy
Useful Links
About usFAQBlogContact
© 2005 - 2025 Rugeast. All rights reserved.
paypalmastercardvisasepa-lastschriftupsdpddhlssltrustedshop

Isfahan

Discover our beautiful collection of carpets

teppich
Home/carpet/orientalcarpets/isfahan
Showing 1-24 of 43 Results
Isfahan Carpet 162x115Isfahan Carpet 162x115 - alternate view

Isfahan Carpet 162x115

3900.00 €
Antique Isfahan Carpet  92x70Antique Isfahan Carpet  92x70 - alternate view

Antique Isfahan Carpet 92x70

850.00 €
Najafabad Carpet 347x226Najafabad Carpet 347x226 - alternate view

Najafabad Carpet 347x226

1600.00 €
Isfahan Carpet 164x109Isfahan Carpet 164x109 - alternate view

Isfahan Carpet 164x109

1350.00 €
Isfahan Carpet  206x149Isfahan Carpet  206x149 - alternate view

Isfahan Carpet 206x149

2450.00 €
Isfahan Davari silk floor Silk carpet 200x130Isfahan Davari silk floor Silk carpet 200x130 - alternate view

Isfahan Davari silk floor Silk carpet 200x130

8500.00 €
Antique Isfahan Carpet 203x142Antique Isfahan Carpet 203x142 - alternate view

Antique Isfahan Carpet 203x142

5900.00 €
Isfahan Davari Silk Warp carpet 203x130Isfahan Davari Silk Warp carpet 203x130 - alternate view

Isfahan Davari Silk Warp carpet 203x130

3950.00 €
Isfahan Silk Warp Carpet 170x109Isfahan Silk Warp Carpet 170x109 - alternate view

Isfahan Silk Warp Carpet 170x109

2750.00 €
Isfahan  Mansuri Silk warp Carpet 195x131Isfahan  Mansuri Silk warp Carpet 195x131 - alternate view

Isfahan Mansuri Silk warp Carpet 195x131

4500.00 €
Najafabad Antique Carpet 325x203Najafabad Antique Carpet 325x203 - alternate view

Najafabad Antique Carpet 325x203

1050.00 €
Najafabad Antique Carpet 282x189Najafabad Antique Carpet 282x189 - alternate view

Najafabad Antique Carpet 282x189

995.00 €
Isfahan Antique Carpet 230x150Isfahan Antique Carpet 230x150 - alternate view

Isfahan Antique Carpet 230x150

3500.00 €
Najafabad carpet 212x140Najafabad carpet 212x140 - alternate view

Najafabad carpet 212x140

1450.00 €
Isfehan Carpet 165x110Isfehan Carpet 165x110 - alternate view

Isfehan Carpet 165x110

1500.00 €
Isfehan Carpet 180x110Isfehan Carpet 180x110 - alternate view

Isfehan Carpet 180x110

1900.00 €
Isfehan Carpet 163x107Isfehan Carpet 163x107 - alternate view

Isfehan Carpet 163x107

1450.00 €
Isfehan Carpet 185x125Isfehan Carpet 185x125 - alternate view

Isfehan Carpet 185x125

1250.00 €
Isfahan Carpet 224x78Isfahan Carpet 224x78 - alternate view

Isfahan Carpet 224x78

1350.00 €
Isfahan Carpet 235x155Isfahan Carpet 235x155 - alternate view

Isfahan Carpet 235x155

3500.00 €
Isfahan  Carpet 315x200Isfahan  Carpet 315x200 - alternate view

Isfahan Carpet 315x200

6000.00 €
Isfahan Carpet 112x68Isfahan Carpet 112x68 - alternate view

Isfahan Carpet 112x68

750.00 €
Isfahan Carpet 104x71Isfahan Carpet 104x71 - alternate view

Isfahan Carpet 104x71

499.00 €
Isfahan Carpet 294x199Isfahan Carpet 294x199 - alternate view

Isfahan Carpet 294x199

5900.00 €

    Isfahan Carpets feature various designs, such as the Shah Abbasi motif, inspired by historical structures in the city of Isfahan, like the Ali Qapu Palace and the Forty Columns Palace. Isfahan handwoven carpets encompass different patterns, including prayer rugs, tree motifs, and more. In the following, we aim to acquaint you with Isfahan handwoven carpets and the buying and selling of this type of Orientalcarpets.

    Isfahan Handwoven Carpets

    Isfahan handwoven carpets are an art that has been prevalent among the people of Isfahan since ancient times and has reached its peak to this day. The growth and flourishing of Isfahan handwoven carpets date back to the Safavid period.

    During that time, Isfahan was the capital of the country, and due to the numerous comings and goings to this city, Isfahan carpets were introduced to all of Iran and even to other countries. To the extent that many people showed interest in buying these carpets, and gradually the number of handwoven carpet weavers in Isfahan increased.

    Isfahan carpets have different designs, such as Shah Abbasi, inspired by historical buildings in the city of Isfahan, such as the Ali Qapu Palace and the Forty Columns Palace.

    Isfahan handwoven carpets feature various designs, such as prayer rugs, tree motifs, and more. In the following, we intend to familiarize you with Isfahan handwoven carpets and the buying and selling of these types of carpets.

    History of Isfahan Handwoven Carpets

    The history and heritage of Isfahan handwoven carpets are exceptionally long, and the production of these masterpieces dates back to the early Safavid era from 1502 to 1722 (16th century AD).

    This period is recognized as the golden age and century of splendid Persian handwoven carpet weaving. Approximately 300 carpets from that era are preserved in the world's largest museums and private collections.

    During this time, there were numerous carpet weaving workshops, and one of these workshops was located in Isfahan. This workshop experienced significant growth and development, producing incredibly beautiful carpets.

    As a result, Isfahan handwoven carpets gained immense popularity worldwide.

    During the reign of Shah Abbas, the capital of Iran shifted from Qazvin to Isfahan, significantly contributing to the reputation of Isfahan's handwoven carpets. This product gained more attention than ever before.

    Characteristics of Isfahan Handwoven Carpets

    As mentioned, the primary structure of most Isfahan handwoven carpet designs follows the logo, Lachak, and Toranj patterns. Islamic motifs and their graceful movements are present in the Lachak and Toranj structures.

    Islamic motifs and frames crafted from their beautiful movements are also visible in the borders of most handwoven carpets. Another visual characteristic of Isfahan handwoven carpets is the twisting of floral stems as a sub-pattern, accompanied by Islamic motif stems and beautiful Shah Abbasi flowers.

    In all Isfahan handwoven carpets, meticulous symmetry is well-preserved in all components, including Lachak, Toranj, borders, corners, and Shah Abbasi flowers.

    Enchanting combinations, traditional designs, and beautiful colorings inspired by historical structures and traditional art in Iran are significant features of Isfahan handwoven carpets. A notable feature of Isfahan carpets is the absence of broken or geometric patterns, and their designs are considered rotational.

    Imitations of the tilework of historical buildings, such as the Sheikh Lotfollah Mosque, are observed in many Isfahan handwoven carpets. Alongside Lachak and Toranj patterns, which are the main patterns of Isfahan carpets, other patterns like Gol-dani, Afshan, and more are also featured on Isfahan handwoven carpets.

    Due to these unique features and characteristics, Isfahan handwoven carpets have become unparalleled, garnering a substantial number of enthusiasts.

    The Finest Isfahan Handwoven Carpets

    Isfahan handwoven carpets represent an artistry that can captivate any observer. When it comes to the art of Isfahan, it's challenging to single out one as the most prominent among the various prevalent arts in this region. Nevertheless, boldly stated, the art of carpet weaving and its product, Isfahan handwoven carpets, stand out as one of the most distinctive and globally recognized arts in this culturally rich city. Isfahan handwoven carpets are a fusion of art and creativity, and their ancient and rich history has transformed this eye-catching product into a legendary art form. The best Isfahan handwoven carpets are those that have preserved their authenticity and, adhering to the ancient art, are intricately woven with captivating colors and patterns. The yarns used for producing Isfahan handwoven carpets are vertical, and the finest Isfahan carpets are woven from these same vertical yarns. The use of attractive and unique Toranj and Lachak patterns in Isfahan carpet weaving, along with the absence of bright shadows, creates a picturesque and elegant landscape.

    Wool, silk, and cotton are the primary fibers used in the weaving of Isfahan handwoven carpets. The use of delicate and beautiful fibers might mislead observers into thinking that the best Isfahan handwoven carpets are not suitable for everyday use and are purely decorative. However, the reality is that when crafted by skilled artisans in this field, these beautiful carpets, due to their durability and proportionate dimensions, can be easily used daily, providing enduring beauty. The best Isfahan handwoven carpets are currently produced in cities and regions such as Najafabad, Falavarjan, Golpayegan, Kashan, Nain, Natanz, and Khansar.

    Silk Isfahan Handwoven Carpets

    Silk Isfahan handwoven carpets are among the finest examples of handwoven carpets in Iran, exported to various countries. Silk Isfahan carpets include entirely silk, double-knotted silk, and silk pile Isfahan carpets, each having different characteristics and prices.

    In addition to its special beauty and attractiveness, purchasing silk Isfahan carpets is considered a form of investment. To view various designs and colors of silk Isfahan carpets and learn about their prices, you can visit the website www. rugeast.com/en

    Conversion of Knot Density in Isfahan Carpets to Centimeters:

    The conversion of knot density in Isfahan carpets to raj measures can be simplified by defining the number of knots per square centimeter. Weavers often use the term "sad-ta'i" (meaning one hundred knots) as a substitute for the term "raj measure." In essence, the number and value of knots per square centimeter indicate the density of the carpet.

    To calculate the number of knots in a carpet and convert it to centimeters, you can use the method described below. An important point to note is that the raj measure, or the equivalent of a yard, may vary in different cities. For instance, in Isfahan, each yard is considered equivalent to 104 centimeters, whereas in Tabriz, it's 112 centimeters.

    Knot Density in Isfahan Carpets:

    The knot density in Isfahan carpets is calculated similarly. If you want to convert the number of knots in Isfahan carpets to centimeters, you can use a proportional approach. They use a scale of 6.5 centimeters to express the number of knots in Isfahan carpets. For example, if they say a carpet has 60 knots, it means there are 60 knots in every 6.5 centimeters of the Isfahan carpet. If the carpet belongs to Tabriz, this scale corresponds to 7 centimeters. So, for the same example, it means there are 60 knots in every 7 centimeters of the Tabriz carpet. Now, to establish proportionality: (In this example, considering the explanation above, 6.5 or 7 is constant, and the number of knots is the variable). In every 6.5 centimeters, there are 60 knots. In every 104 centimeters (each yard in Isfahan equals 104 centimeters), how many knots are there? Or, if you have the number of knots, you can put it in the formula to find out the number of centimeters. In this case, the centimeter value can be considered unknown while the number of knots is known.

    Calculating the Number of Knots in Handwoven Carpets:

    The number of knots in handwoven carpets is calculated as follows. If you have obtained the number of knots using the proportion mentioned above, multiply this answer by the length of the carpet to find the total number of knots along the length. Similarly, if the obtained number of knots is multiplied by the width according to the proportion, the total number of knots across the width of the carpet will be determined. Now, if the result of multiplying the number of knots by the length or width of the carpet is divided by two, the number of knots in half of the carpet will be obtained. To determine the number of knots in the border of the carpet, divide the obtained number of knots from the initial proportion by three. However, there's an easier way to calculate the number of knots in a meter of carpet, which is to multiply the constant number 16 by the knot count (raj measure) of the carpet to obtain the number of knots per meter.

    Calculation of the Number of Knots in Handwoven Carpets:

    We will explain the calculation of the number of knots in handwoven carpets in general terms. They use the unit kpsi (knots per square inch) to count the number of knots in a carpet. The function of kpsi is similar to the pixels in an image, and the higher the number of pixels (which are actually knots), the better the quality and clarity. To obtain kpsi, simply count the number of knots in one inch of length and one inch of width and multiply them together. This will give you kpsi. This method is more commonly used in America and England. In Isfahan and Tabriz carpets, instead of kpsi, the raj measure is used. If you still have questions in this regard, you can contact the experts at KalaDozan website.

    Most Common Patterns in Isfahan Handwoven Carpets

    The majority of patterns seen in Isfahan handwoven carpets are Toranj and Lachak patterns. If you carefully observe different places such as the Sheikh Lotfollah Mosque, Ali Qapu structures, Gunbad-e-Lajvardi Mosque, Forty Columns, and Eight Paradises, you will notice abundant use of Toranj and Lachak patterns.

    Other patterns in Isfahan handwoven carpets include floral patterns, hunting scenes, Toranj-e-Afshan, and Sultan's Shadow.

    Patterns of Isfahan Handwoven Carpets

    Today, most patterns seen in Isfahan handwoven carpets are Lachak and Toranj. However, there are other types of patterns used in Isfahan handwoven carpets, and below are a few examples:

    - Patterns such as Sajjadieh, Mihrab with Columns, Tree patterns, and Hunting scenes are frequently seen in Isfahan handwoven carpets.

    - Patterns like Gol-dan, hunting scenes, Islamic motifs, Pi-chak, and serpentine lines are other commonly used patterns in Isfahan handwoven carpets.

    - Patterns inspired by tilework of Safavid-era buildings, such as Imam Mosque and Sheikh Lotfollah, are widely used in Isfahan carpets.

    - One of the most common patterns is the Shah Abbasi Toranj, which has many admirers in this region. Patterns like Toranj-e-Afshan and Sultan's Shadow are also considered popular patterns among carpet weavers in this area.

    - Some Isfahan carpets use the pattern of the Gonbad-e-Isfahan, derived from the Safavid-era structure, which has many fans

    Isfahan Handwoven Carpets - 6 Meters

    Isfahan handwoven carpets are available in various sizes, including 6 meters, with dimensions such as 3x4, crafted by Isfahan's skilled artisans and readily accessible in the market. The 6-meter Isfahan handwoven carpet can be made of either silk or Kork, both known for their high quality, making them popular among many individuals. The features of Isfahan's 6-meter handwoven carpets include:

    - Natural plant-based colors

    - Greater shine and luster compared to machine-made carpets

    - Flexible pile

    - Crafted with natural fibers

    Second-Category Isfahan Handwoven Carpets

    Due to the frequent use of carpets, individuals may decide to replace them due to changes in taste, design, color, or size. Second-category Isfahan handwoven carpets, being more affordable than new carpets, become a suitable option for export, making them appealing to carpet sellers who may choose to exchange new carpets for second-category ones.

    It's important not to perceive second-category Isfahan handwoven carpets negatively merely because they are not new. In fact, these carpets, regardless of their age, can possess unique charm, and individuals may sell them due to changes in decoration or personal preferences.

    Isfahan Handwoven Carpet Buyers

    Given the high quality of Isfahan handwoven carpets, they may change hands several times throughout the country and even in foreign countries due to their traditional patterns and appealing designs. Buyers of Isfahan handwoven carpets can be found nationwide, expressing their interest in purchasing these handcrafted artworks, both new and second-category, either through physical presence or online.

    When buying Isfahan handwoven carpets, it is essential to consider the following:

    - Examining the symmetry of the carpet

    - Color stability in Isfahan handwoven carpets

    - The overall health of the carpet

    - Assessing uniformity and density in the carpet's weaving

    Isfahan Handwoven Carpet Sales

    Sales of Isfahan handwoven carpets have become a lucrative business due to their unique beauty in color and traditional patterns. Sales can occur through both physical and online channels. To increase sales, having a complete understanding of customer preferences is crucial. By aligning with customers' tastes, sellers can expedite the process of selling carpets.

    For those engaged in selling Isfahan handwoven carpets, obtaining information about the customer's desired type of carpet before crafting it can ensure the delivery of high-quality, tailor-made carpets. Isfahan's second-category handwoven carpets are more budget-friendly, making them an excellent choice for buyers to acquire high-quality carpets at affordable prices.

    Pricing of Isfahan Handwoven Carpets

    The pricing of Isfahan handwoven carpets, including 12-meter carpets, is influenced by various factors:

    - The larger size of 12-meter Isfahan handwoven carpets contributes to a higher price.

    - The type of fiber used directly affects the carpet's price. Higher-quality fibers result in higher prices.

    - The design and pattern of the carpet impact its price, with unique and intricate designs commanding higher prices.

    Factors Influencing the Price of Isfahan Handwoven Carpets

    Various factors contribute to the pricing of Isfahan handwoven carpets:

    - Weaving style

    - Fiber color

    - Knotting technique

    - Fiber material

    - Carpet size

    - Carpet lifespan

    Considerations for Washing Isfahan Handwoven Carpets

    Given the significance and high price of Isfahan handwoven carpets, proper care is essential. Washing them incorrectly can cause damage. In the past, natural dyes were used for coloring the fibers, and the carpets were then washed in salty rivers to set the colors. Therefore, you can entrust your Isfahan handwoven carpets to a reputable and specialized carpet cleaning center for proper care.

    Online Purchase of Isfahan Handwoven Carpets

    Isfahan handwoven carpets, renowned for their captivating beauty, have gained a large following. You can make your purchase of Isfahan handwoven carpets either in person or online.

    Online buying of Isfahan handwoven carpets provides you with the opportunity to make the best choice while saving time and costs. An easy way to make an online purchase of Isfahan handwoven carpets is to visit reputable websites. You should choose a site that offers a variety of high-quality Isfahan handwoven carpets at reasonable prices.

    Here, we introduce you to the rugeast store, which provides customers with the best types of carpets at cost-effective prices. You can confidently and comfortably proceed with the purchase of your favorite Isfahan handwoven carpet.

    Last Words

    Isfahan handwoven carpets have garnered a significant following due to their unique beauty and allure. Many individuals are actively involved in the buying and selling of Isfahan handwoven carpets. These carpets feature traditional patterns inspired by various historical structures and can be woven in any size or dimension as per the customer's preference. The pricing of Isfahan handwoven carpets is determined by various factors.

    You can engage in the purchase or sale of Isfahan handwoven carpets either in person or online. One reputable website that operates in the field of buying and selling Isfahan handwoven carpets, offering the best-quality carpets at excellent prices, is www. https://rugeast.com/en Our recommendation to you is to trust this website, enabling you to confidently participate in buying and selling Isfahan handwoven carpets. We hope to have acquainted you well with Isfahan handwoven carpets.

    View All
    Abadeh
    Abadeh
    Afghan & Pakistan Rugs
    Afghan & Pakistan Rugs
    Ardebil
    Ardebil
    Bidjar
    Bidjar
    Chinese Rugs
    Chinese Rugs
    Exclusive Carpets
    Exclusive Carpets
    Ghom
    Ghom
    Indian Carpets
    Indian Carpets
    Isfahan
    Isfahan
    Kashan
    Kashan
    Mashhad
    Mashhad
    Kerman
    Kerman
    Kashmar
    Kashmar
    Moud
    Moud
    Nain
    Nain
    Sarough
    Sarough
    Silk rugs
    Silk rugs
    Tabriz
    Tabriz
    Zanjan
    Zanjan
    Ziegler/Kazak
    Ziegler/Kazak