Free shipping & free returns
31-day return policy
Since 1921: Your expert for hand-knotted oriental rugs
About us
Contact us
FAQ
Rugeast Logo
Home
Traditional and Persian Rugs
Nomadic- Village Carpets
Modern Rugs
Machine made carpets
Antique Rugs
All Carpets
Rugeast – Tradition Since 1921
For over three generations, our family has been devoted to the art of handcrafted carpets. From the historic bazaars of Tehran to Hamburg’s Speicherstadt, Rugeast blends tradition with modern innovation, bringing unique carpets from around the world directly to you.
Showroom
Brook 9
20457 Hamburg
Germany
Contact
+49(0) 40 37 50 27 66
info[@]rugeast.com
Opening hours
Monday to Friday - 08:00 to 18:00
Saturday - 09:00 to 15:00
Sunday - Closed
Services
Terms of useImprintReturn PolicyPrivacy Policy
Useful Links
About usFAQBlogContact
© 2005 - 2025 Rugeast. All rights reserved.
paypalmastercardvisasepa-lastschriftupsdpddhlssltrustedshop

Ardebil

Discover our beautiful collection of carpets

teppich
Home/carpet/orientalcarpets/ardebil
Showing 1-24 of 66 Results
Ardebil  Carpet  406x101Ardebil  Carpet  406x101 - alternate view

Ardebil Carpet 406x101

600.00 €
Ardebil Carpet 198x133Ardebil Carpet 198x133 - alternate view

Ardebil Carpet 198x133

1,100.00 €
Ardebil Carpet 140x86Ardebil Carpet 140x86 - alternate view

Ardebil Carpet 140x86

650.00 €
Azerbeijan Carpets 397x103Azerbeijan Carpets 397x103 - alternate view

Azerbeijan Carpets 397x103

780.00 €
Azerbeijan Carpets  285x120Azerbeijan Carpets  285x120 - alternate view

Azerbeijan Carpets 285x120

2,100.00 €
Azerbeijan Carpet 341x100Azerbeijan Carpet 341x100 - alternate view

Azerbeijan Carpet 341x100

660.00 €
Azerbeijan Carpet  390x104Azerbeijan Carpet  390x104 - alternate view

Azerbeijan Carpet 390x104

750.00 €
Azerbeijan Carpet 302x113Azerbeijan Carpet 302x113 - alternate view

Azerbeijan Carpet 302x113

650.00 €
Azerbeijan Carpet  329x112Azerbeijan Carpet  329x112 - alternate view

Azerbeijan Carpet 329x112

650.00 €
Azerbeijan  Carpet 365x119Azerbeijan  Carpet 365x119 - alternate view

Azerbeijan Carpet 365x119

1,550.00 €
Azrbeijan Carpet 254x169Azrbeijan Carpet 254x169 - alternate view

Azrbeijan Carpet 254x169

2,650.00 €
Meshkin Carpet 316x210Meshkin Carpet 316x210 - alternate view

Meshkin Carpet 316x210

1,950.00 €
Azerbeijan Carpet  425x140Azerbeijan Carpet  425x140 - alternate view

Azerbeijan Carpet 425x140

599.00 €
Azerbeijan Carpet 307x82Azerbeijan Carpet 307x82 - alternate view

Azerbeijan Carpet 307x82

449.00 €
Ardebil Carpet  286x59Ardebil Carpet  286x59 - alternate view

Ardebil Carpet 286x59

450.00 €
Ardebil Antique Carpet 320x76Ardebil Antique Carpet 320x76 - alternate view

Ardebil Antique Carpet 320x76

690.00 €
Meshkien Antique Carpet  378x105Meshkien Antique Carpet  378x105 - alternate view

Meshkien Antique Carpet 378x105

795.00 €
Meshkien Antique Carpet 336x165Meshkien Antique Carpet 336x165 - alternate view

Meshkien Antique Carpet 336x165

1,900.00 €
Ardebiel Carpet  200x134Ardebiel Carpet  200x134 - alternate view

Ardebiel Carpet 200x134

750.00 €
-20%
ARDEBIL Carpet 442x110ARDEBIL Carpet 442x110 - alternate view

ARDEBIL Carpet 442x110

699.00 €559.20 €
ARDEBIL Carpet 442x110ARDEBIL Carpet 442x110 - alternate view

ARDEBIL Carpet 442x110

699.00 €
Ardebil Carpet 353x128Ardebil Carpet 353x128 - alternate view

Ardebil Carpet 353x128

890.00 €
Ardebil Carpet 312x124Ardebil Carpet 312x124 - alternate view

Ardebil Carpet 312x124

590.00 €
Ardebil Carpet  400x104Ardebil Carpet  400x104 - alternate view

Ardebil Carpet 400x104

850.00 €
  • 1
  • 2
  • 3
Load More

Ardebil Province Geographical

Area Ardebil province was previously considered part of East Azerbaijan province on geographical maps, but over the past three decades, it has become an independent province (Azarpad and Hashemi Razavi, 1372, p. 258). The province is bordered to the north by Iran and the Republic of Azerbaijan, to the east by the Talesh and Hashtrud mountains and Gilan province, to the south by Zanjan, and to the west by East Azerbaijan province.

Due to the mountainous nature of this province, its favorable climate, and geographical conditions, animal husbandry—especially sheep farming of various breeds—is widespread. The name Ardebil literally means "high place." In addition to the city of Ardebil, cities and villages such as Pileh, Sivar, Parsabad, Givi, Khalkhal, Germi, Meshgin Shahr, and Namin are part of Ardebil Province.

The rural residents and nomads, using sheep's wool and thread imported from Tabriz and other regions, are engaged in carpet weaving, which is a common and long-established craft in the area. Carpet weaving in the Ardebil region, due to its style and technique, as well as its historical roots, can be considered part of the Azerbaijani carpet weaving tradition, regardless of geographical boundaries.

Today, because carpet weaving is one of the most important sources of income for the local community and a significant production activity in Ardebil, this craft has flourished in the province. This boom has made Ardebil carpets highly sought after both domestically and internationally (Sabahi, 1390, p. 300).

Carpet weaving in Ardebil province can be divided into three categories: urban weaving, rural weaving, and nomadic weaving. Urban weaving is mainly centered in the city of Ardebil and is distinguished by the designs of the carpets produced, which often feature intricate patterns.

The dominant design in urban weaving in Ardebil is a repeated pattern known as the "Mahi" (fish) motif. In rural weaving, carpet production is widespread in most village carpets of Ardebil. The main period of activity for rural weaving corresponds to the agricultural off-season, from early autumn to late winter.

Ardebil Carpet

Therefore, with the arrival of warmer weather and the villagers' engagement in agriculture, carpet production decreases accordingly. Most of the weavers in rural areas are women and girls. Rural carpets are typically produced with simple, geometric designs.

The nomadic weaving sector is limited to the nomads who migrate to Ardebil during the warm season for summer pastures. In this sector, like in rural weaving, women and girls are the primary weavers. Carpets in this sector are not woven solely for income but are also made for personal use.

One characteristic of the carpets produced in this region is that all stages of production, from wool spinning to dyeing, are carried out by the nomads themselves, specifically by the women. In this sector, warping is done on small, horizontal looms, and the carpets produced have low density and knot counts. Additionally, the warp threads are made of wool, and these carpets are referred to as "all-wool" carpets (Bahrami, 1398).

Historical and Artistic Legacy of Ardebil

Ardebil, a city with a long and rich history of culture, has always been one of the significant centers of Iran due to its geographical location and historical importance, serving as a host to various civilizations.

Ancient History

  • Pre-Islamic Era: The historical roots of Ardebil date back to pre-Islamic times. In ancient times, it was recognized as one of the key centers of Azerbaijan.
  • Islamic Era: With the advent of Islam in Iran, Ardebil maintained its significance and became one of the important centers of Shi'ism in the region.
  • Safavid Dynasty: One of the most notable historical events for Ardebil is the rise of the Safavid dynasty. Sheikh Safi al-Din Ardebili, the great ancestor of this dynasty, is buried in the city, and his mausoleum has become a major pilgrimage site for Shiites.
  • Qajar Era and Beyond: During the Qajar period and afterward, Ardebil was recognized as one of the significant cultural and commercial cities of Iran.
Ardebil Carpet 2

A Treasure Trove of Historical and Artistic Monuments

Due to its rich history, Ardebil is home to numerous valuable historical and artistic monuments, including:

  • Sheikh Safi al-Din Ardebili's Mausoleum: This magnificent mausoleum is one of the most beautiful examples of Islamic architecture in Iran and is of great historical and artistic importance.
  • Jameh Mosque of Ardebil: This ancient mosque is one of the oldest in Iran and features a simple yet beautiful architectural style.
  • Shah Abbas Caravanserai: Built during the Safavid era, this caravanserai is a fine example of Iranian caravanserai architecture.
  • Roudshir Castle: This historic castle is one of the oldest in Iran and is significant for its military architecture.
  • Museums: Ardebil has several museums that house valuable historical and artistic artifacts.

The people of Ardebil have a rich and diverse culture, rooted in the region's history and geography. Ardebil’s handicrafts, music, literature, and local cuisine reflect the cultural identity of the region.

Natural Attractions

In addition to its historical and artistic sites, Ardebil boasts stunning natural attractions. Mount Sabalan, one of the most beautiful mountains in Iran, is located near Ardebil. The hot springs of Sarein are another major natural attraction in the region.

The Tradition of Carpet Weaving in Ardebil

Carpet weaving in Ardebil has deep roots in the city's ancient history and is one of its most important handicrafts and arts. Ardebil carpets are renowned worldwide for their beautiful designs, vibrant colors, and durable craftsmanship, representing an ancient art form.

A Brief History of Carpet Weaving in Ardebil

Carpet weaving in Ardebil has been practiced for centuries and remains a significant cultural and economic activity in the province. From nomadic traditions to urban workshops, the artistry of Ardebil carpets reflects the fusion of heritage, craftsmanship, and creativity.

FAQ – Frequently Asked Questions about Ardebil Carpets

Ardebil carpets are mainly woven from high-quality Persian wool, sometimes combined with silk for a more refined look. Traditional weaving techniques and natural dyes ensure durability and vibrant, long-lasting colors.
Yes — most dealers and specialized carpet shops ship Ardebil carpets across Europe and worldwide. Shipping costs and delivery times depend on the size/weight of the carpet and the destination country. Always check the seller’s shipping and customs policies before ordering.
Regular gentle vacuuming (without a rotating brush), immediate spot cleaning with cold water and mild soap, and occasional professional cleaning will keep your Ardebil carpet in excellent condition. Avoid direct sunlight for long periods to prevent fading.

Tip: Click on a question to expand or collapse the answer.

View All
Abadeh
Abadeh
Afghan & Pakistan Rugs
Afghan & Pakistan Rugs
Ardebil
Ardebil
Bidjar
Bidjar
Chinese Rugs
Chinese Rugs
Exclusive Carpets
Exclusive Carpets
Ghom
Ghom
Indian Carpets
Indian Carpets
Isfahan
Isfahan
Kashan
Kashan
Mashhad
Mashhad
Kerman
Kerman
Kashmar
Kashmar
Moud
Moud
Nain
Nain
Sarough
Sarough
Silk rugs
Silk rugs
Tabriz
Tabriz
Zanjan
Zanjan
Ziegler/Kazak
Ziegler/Kazak